Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZCCHC3 Rabbit pAb (A17235)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - ZCCHC3 Rabbit pAb (A17235)

Western blot analysis of various lysates using ZCCHC3 Rabbit pAb (A17235) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunofluorescence - ZCCHC3 Rabbit pAb (A17235)

Immunofluorescence analysis of L929 cells using ZCCHC3 Rabbit pAb (A17235) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ZCCHC3 Rabbit pAb
Catalog No. A17235
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables double-stranded DNA binding activity. Involved in several processes, including cellular response to exogenous dsRNA; detection of virus; and positive regulation of RIG-I signaling pathway. Located in cytoplasm.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 215-335 of human ZCCHC3 (NP_149080.2).
Sequence SFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTC
Gene ID 85364
Swiss prot Q9NUD5
Synonyms C20orf99; ZCCHC3
Calculated MW 44kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples LO2, mouse liver
Cellular location cytoplasm
Customer validation

WB (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ZCCHC3 Rabbit pAb images

ABclonal:Western blot - ZCCHC3 Rabbit pAb (A17235)}

Western blot - ZCCHC3 Rabbit pAb (A17235)

Western blot analysis of various lysates using ZCCHC3 Rabbit pAb (A17235) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunofluorescence - ZCCHC3 Rabbit pAb (A17235)}

Immunofluorescence - ZCCHC3 Rabbit pAb (A17235)

Immunofluorescence analysis of L929 cells using ZCCHC3 Rabbit pAb (A17235) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A17235 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZCCHC3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZCCHC3. (Distance between topics and target gene indicate popularity.) ZCCHC3

* Data provided by citexs.com, for reference only.

Publishing research using A17235? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order