Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ZC3H11A Rabbit pAb (A10044)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - ZC3H11A Rabbit pAb (A10044)

Western blot analysis of extracts of various cell lines, using ZC3H11A antibody (A10044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name ZC3H11A Rabbit pAb
Catalog No. A10044
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables RNA binding activity. Involved in poly(A)+ mRNA export from nucleus. Colocalizes with transcription export complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ZC3H11A (NP_055642.3).
Sequence MPNQGEDCYFFFYSTCTKGDSCPFRHCEAAIGNETVCTLWQEGRCFRQVCRFRHMEIDKKRSEIPCYWENQPTGCQKLNCAFHHNRGRYVDGLFLPPSKTVLPTVPESPEEEVKASQLSVQQNKLSVQSNPSPQLRSVMKVESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTPTLQPTPEVHNGLRVTSVRKPAVNIKQGECLNFGIKTLEEIKSKKMKEKSKKQGEGSSGVSSLLLHPEPVPGPEKENVRTVVRTVTLSTKQ
Gene ID 9877
Swiss prot O75152
Synonyms ZC3HDC11A; ZC3H11A
Calculated MW 89kDa
Observed MW 120kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:4000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, HeLa, Jurkat, MCF7
Cellular location nucleoplasm

Research Area

ZC3H11A Rabbit pAb images

ABclonal:Western blot - ZC3H11A Rabbit pAb (A10044)}

Western blot - ZC3H11A Rabbit pAb (A10044)

Western blot analysis of extracts of various cell lines, using ZC3H11A antibody (A10044) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A10044 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ZC3H11A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ZC3H11A. (Distance between topics and target gene indicate popularity.) ZC3H11A

* Data provided by citexs.com, for reference only.

Publishing research using A10044? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order