Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

YAP1 Rabbit pAb (A1002)

Reviews (8) Publications (36) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - YAP1 Rabbit pAb (A1002)

Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO) HeLa cells using YAP1 Rabbit pAb (A1002) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 30s.

ABclonal:Immunohistochemistry - YAP1 Rabbit pAb (A1002)

Immunohistochemistry analysis of YAP1 in paraffin-embedded Human colon (low expression samples) using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - YAP1 Rabbit pAb (A1002)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human colon carcinoma using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - YAP1 Rabbit pAb (A1002)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human liver cancer using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - YAP1 Rabbit pAb (A1002)

Confocal immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:200. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - YAP1 Rabbit pAb (A1002)

Immunofluorescence analysis of NIH/3T3 cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - YAP1 Rabbit pAb (A1002)

Immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - YAP1 Rabbit pAb (A1002)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 antibody (A1002) at a dilution of 1:1000.

ABclonal:Immunoprecipitation - YAP1 Rabbit pAb (A1002)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 (A1002) at a dilution of 1:1000.

Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)
Review
ABclonal: review for YAP1 Rabbit pAb(A1002)

You may also interested in:

Overview

Product name YAP1 Rabbit pAb
Catalog No. A1002
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Sequence PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Gene ID 10413
Swiss prot P46937
Synonyms YAP; YKI; COB1; YAP2; YAP-1; YAP65; YAP1
Calculated MW 54kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
IF/ICC HumanMouse
IHC-P Human
WB HumanMouse
Recommended dilution
  • WB 1:2000 - 1:20000
  • IHC-P 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa
Cellular location Cytoplasm, Nucleus
Customer validation

WB (THP1, 293T, HEK293T,MCF7Homo sapiens, Mus musculus, Homo sapiens, Sus scrofa)

IF (Peritoneal macrophage, MG63, DLD-1Homo sapiens, Mus musculus, Homo sapiens, Danio rerio, Sus scrofa)

IHC (Human breast cancerMus musculus, Homo sapiens, Mus musculus, Rattus norvegicus)

ChIP (Homo sapiens)

ICC (Mus musculus)

IHCIF (Mus musculus)

IP (Homo sapiens)

co-IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

YAP1 Rabbit pAb images

ABclonal:Western blot - YAP1 Rabbit pAb (A1002)}

Western blot - YAP1 Rabbit pAb (A1002)

Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO) HeLa cells using YAP1 Rabbit pAb (A1002) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 30s.
ABclonal:Immunohistochemistry - YAP1 Rabbit pAb (A1002)}

Immunohistochemistry - YAP1 Rabbit pAb (A1002)

Immunohistochemistry analysis of YAP1 in paraffin-embedded Human colon (low expression samples) using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - YAP1 Rabbit pAb (A1002)}

Immunohistochemistry - YAP1 Rabbit pAb (A1002)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human colon carcinoma using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - YAP1 Rabbit pAb (A1002)}

Immunohistochemistry - YAP1 Rabbit pAb (A1002)

Immunohistochemistry analysis of YAP1 in paraffin-embedded human liver cancer using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - YAP1 Rabbit pAb (A1002)}

Immunofluorescence - YAP1 Rabbit pAb (A1002)

Confocal immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:200. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - YAP1 Rabbit pAb (A1002)}

Immunofluorescence - YAP1 Rabbit pAb (A1002)

Immunofluorescence analysis of NIH/3T3 cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - YAP1 Rabbit pAb (A1002)}

Immunofluorescence - YAP1 Rabbit pAb (A1002)

Immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - YAP1 Rabbit pAb (A1002)}

Immunoprecipitation - YAP1 Rabbit pAb (A1002)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 antibody (A1002) at a dilution of 1:1000.
ABclonal:Immunoprecipitation - YAP1 Rabbit pAb (A1002)}

Immunoprecipitation - YAP1 Rabbit pAb (A1002)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 (A1002) at a dilution of 1:1000.

Submit an review for A1002

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1002 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on YAP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to YAP1. (Distance between topics and target gene indicate popularity.) YAP1

* Data provided by citexs.com, for reference only.

Publishing research using A1002? Please let us know so that we can cite the reference in this datasheet.

Antibodies (13)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order