Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

Ku70 Rabbit pAb (A7330)

Reviews (2) Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Ku70 Rabbit pAb (A7330)

Western blot analysis of various lysates using Ku70 Rabbit pAb (A7330) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - Ku70 Rabbit pAb (A7330)

Immunohistochemistry analysis of Ku70 in paraffin-embedded rat brain using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Ku70 Rabbit pAb (A7330)

Immunohistochemistry analysis of Ku70 in paraffin-embedded human gastric cancer using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Ku70 Rabbit pAb (A7330)

Immunohistochemistry analysis of Ku70 in paraffin-embedded human uterus using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Ku70 Rabbit pAb (A7330)

Immunofluorescence analysis of A549 cells using Ku70 Rabbit pAb (A7330). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - Ku70 Rabbit pAb (A7330)

Confocal immunofluorescence analysis of U2OS cells using Ku70 Rabbit pAb (A7330) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Ku70 Rabbit pAb (A7330)

Immunoprecipitation analysis of 100 μg extracts of SW480 cells using 3 μg Ku70 antibody (A7330). Western blot was performed from the immunoprecipitate using Ku70 antibody (A7330) at a dilution of 1:1000.

Review
ABclonal: review for Ku70 Rabbit pAb(A7330)
Review
ABclonal: review for Ku70 Rabbit pAb(A7330)

You may also interested in:

Overview

Product name Ku70 Rabbit pAb
Catalog No. A7330
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 501-600 of human Ku70 (NP_001460.1).
Sequence EQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
Gene ID 2547
Swiss prot P12956
Synonyms ML8; KU70; TLAA; CTC75; CTCBF; G22P1; Ku70
Calculated MW 70kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples COS-7, SW480, Mouse brain
Cellular location Chromosome, Nucleus
Customer validation

IF (Human renal epithelial cell lineHomo sapiens, Homo sapiens)

IP (Human renal epithelial cell lineHomo sapiens)

WB (Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Ku70 Rabbit pAb images

ABclonal:Western blot - Ku70 Rabbit pAb (A7330)}

Western blot - Ku70 Rabbit pAb (A7330)

Western blot analysis of various lysates using Ku70 Rabbit pAb (A7330) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - Ku70 Rabbit pAb (A7330)}

Immunohistochemistry - Ku70 Rabbit pAb (A7330)

Immunohistochemistry analysis of Ku70 in paraffin-embedded rat brain using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Ku70 Rabbit pAb (A7330)}

Immunohistochemistry - Ku70 Rabbit pAb (A7330)

Immunohistochemistry analysis of Ku70 in paraffin-embedded human gastric cancer using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Ku70 Rabbit pAb (A7330)}

Immunohistochemistry - Ku70 Rabbit pAb (A7330)

Immunohistochemistry analysis of Ku70 in paraffin-embedded human uterus using Ku70 Rabbit pAb (A7330) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Ku70 Rabbit pAb (A7330)}

Immunofluorescence - Ku70 Rabbit pAb (A7330)

Immunofluorescence analysis of A549 cells using Ku70 Rabbit pAb (A7330). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - Ku70 Rabbit pAb (A7330)}

Immunofluorescence - Ku70 Rabbit pAb (A7330)

Confocal immunofluorescence analysis of U2OS cells using Ku70 Rabbit pAb (A7330) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - Ku70 Rabbit pAb (A7330)}

Immunoprecipitation - Ku70 Rabbit pAb (A7330)

Immunoprecipitation analysis of 100 μg extracts of SW480 cells using 3 μg Ku70 antibody (A7330). Western blot was performed from the immunoprecipitate using Ku70 antibody (A7330) at a dilution of 1:1000.

Submit an review for A7330

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A7330 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on XRCC6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to XRCC6. (Distance between topics and target gene indicate popularity.) XRCC6

* Data provided by citexs.com, for reference only.

Publishing research using A7330? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order