Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

XAB2 Rabbit pAb (A13796)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - XAB2 Rabbit pAb (A13796)

Western blot analysis of extracts of various cell lines, using XAB2 antibody (A13796) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.

You may also interested in:

Overview

Product name XAB2 Rabbit pAb
Catalog No. A13796
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Involved in mRNA splicing, via spliceosome; transcription, DNA-templated; and transcription-coupled nucleotide-excision repair. Located in nucleoplasm. Part of U2-type catalytic step 2 spliceosome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 761-855 of human XAB2 (NP_064581.2).
Sequence PGQSGMDDMKLLEQRAEQLAAEAERDQPLRAQSKILFVRSDASREELAELAQQVNPEEIQLGEDEDEDEMDLEPNEVRLEQQSVPAAVFGSLKED
Gene ID 56949
Swiss prot Q9HCS7
Synonyms HCNP; HCRN; SYF1; NTC90; XAB2
Calculated MW 100kDa
Observed MW 105kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, A-549, LO2, HeLa
Cellular location Nucleus

Research Area

XAB2 Rabbit pAb images

ABclonal:Western blot - XAB2 Rabbit pAb (A13796)}

Western blot - XAB2 Rabbit pAb (A13796)

Western blot analysis of extracts of various cell lines, using XAB2 antibody (A13796) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.

Inquire About This Product

Submit your question about A13796 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on XAB2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to XAB2. (Distance between topics and target gene indicate popularity.) XAB2

* Data provided by citexs.com, for reference only.

Publishing research using A13796? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order