Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

WIPF1 Rabbit pAb (A17003)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - WIPF1 Rabbit pAb (A17003)

Western blot analysis of various lysates using WIPF1 Rabbit pAb (A17003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - WIPF1 Rabbit pAb (A17003)

Immunohistochemistry analysis of WIPF1 in paraffin-embedded human appendix using WIPF1 Rabbit pAb (A17003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - WIPF1 Rabbit pAb (A17003)

Immunohistochemistry analysis of WIPF1 in paraffin-embedded human esophageal using WIPF1 Rabbit pAb (A17003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - WIPF1 Rabbit pAb (A17003)

Immunohistochemistry analysis of WIPF1 in paraffin-embedded mouse spleen using WIPF1 Rabbit pAb (A17003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name WIPF1 Rabbit pAb
Catalog No. A17003
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human WIPF1 (NP_001070737.1).
Sequence QLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPP
Gene ID 7456
Swiss prot O43516
Synonyms WIP; WAS2; PRPL-2; WASPIP; WIPF1
Calculated MW 51kDa
Observed MW 51kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples RAW264.7, Mouse spleen
Cellular location actin cytoskeleton, cytoplasmic vesicle, cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

WIPF1 Rabbit pAb images

ABclonal:Western blot - WIPF1 Rabbit pAb (A17003)}

Western blot - WIPF1 Rabbit pAb (A17003)

Western blot analysis of various lysates using WIPF1 Rabbit pAb (A17003) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunohistochemistry - WIPF1 Rabbit pAb (A17003)}

Immunohistochemistry - WIPF1 Rabbit pAb (A17003)

Immunohistochemistry analysis of WIPF1 in paraffin-embedded human appendix using WIPF1 Rabbit pAb (A17003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - WIPF1 Rabbit pAb (A17003)}

Immunohistochemistry - WIPF1 Rabbit pAb (A17003)

Immunohistochemistry analysis of WIPF1 in paraffin-embedded human esophageal using WIPF1 Rabbit pAb (A17003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - WIPF1 Rabbit pAb (A17003)}

Immunohistochemistry - WIPF1 Rabbit pAb (A17003)

Immunohistochemistry analysis of WIPF1 in paraffin-embedded mouse spleen using WIPF1 Rabbit pAb (A17003) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A17003 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on WIPF1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to WIPF1. (Distance between topics and target gene indicate popularity.) WIPF1

* Data provided by citexs.com, for reference only.

Publishing research using A17003? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order