Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)

KO/KDValidated

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)

Western blot analysis of extracts of various cell lines, using NSD3/NSD3/WHSC1L1 antibody (A5577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)

Western blot analysis of extracts from normal (control) and NSD3/WHSC1L1 knockout (KO) 293T cells, using NSD3/WHSC1L1 antibody (A5577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name [KO Validated] NSD3/WHSC1L1 Rabbit pAb
Catalog No. A5577
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is related to the Wolf-Hirschhorn syndrome candidate-1 gene and encodes a protein with PWWP (proline-tryptophan-tryptophan-proline) domains. This protein methylates histone H3 at lysine residues 4 and 27, which represses gene transcription. Two alternatively spliced variants have been described.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human NSD3/NSD3/WHSC1L1 (NP_060248.2).
Sequence EEALSQAKKSVASKTEVKKTRRPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLPASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQDRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
Gene ID 54904
Swiss prot Q9BZ95
Synonyms KMT3F; KMT3G; WHISTLE; WHSC1L1; pp14328; L1
Calculated MW 162kDa
Observed MW 180kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T
Cellular location Chromosome, Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

[KO Validated] NSD3/WHSC1L1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)}

Western blot - [KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)

Western blot analysis of extracts of various cell lines, using NSD3/NSD3/WHSC1L1 antibody (A5577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - [KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)}

Western blot - [KO Validated] NSD3/WHSC1L1 Rabbit pAb (A5577)

Western blot analysis of extracts from normal (control) and NSD3/WHSC1L1 knockout (KO) 293T cells, using NSD3/WHSC1L1 antibody (A5577) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A5577 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NSD3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NSD3. (Distance between topics and target gene indicate popularity.) NSD3

* Data provided by citexs.com, for reference only.

Publishing research using A5577? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order