Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

WDR45 Rabbit pAb (A7581)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - WDR45 Rabbit pAb (A7581)

Western blot analysis of extracts of various cell lines, using WDR45 antibody (A7581) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - WDR45 Rabbit pAb (A7581)

Immunofluorescence analysis of NIH/3T3 cells using WDR45 Rabbit pAb (A7581) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - WDR45 Rabbit pAb (A7581)

Immunofluorescence analysis of PC-12 cells using WDR45 Rabbit pAb (A7581) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name WDR45 Rabbit pAb
Catalog No. A7581
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene has a pseudogene at chromosome 4q31.3. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity and full-length nature of some variants have not been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-148 of human WDR45 (NP_001025067.1).
Sequence EPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGSSPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDTRDNPKGLC
Gene ID 11152
Swiss prot Q9Y484
Synonyms JM5; NBIA4; NBIA5; WDRX1; WIPI4; WIPI-4; WDR45
Calculated MW 40kDa
Observed MW 39kDa/35kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse skeletal muscle, Rat lung
Cellular location cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

WDR45 Rabbit pAb images

ABclonal:Western blot - WDR45 Rabbit pAb (A7581)}

Western blot - WDR45 Rabbit pAb (A7581)

Western blot analysis of extracts of various cell lines, using WDR45 antibody (A7581) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - WDR45 Rabbit pAb (A7581)}

Immunofluorescence - WDR45 Rabbit pAb (A7581)

Immunofluorescence analysis of NIH/3T3 cells using WDR45 Rabbit pAb (A7581) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - WDR45 Rabbit pAb (A7581)}

Immunofluorescence - WDR45 Rabbit pAb (A7581)

Immunofluorescence analysis of PC-12 cells using WDR45 Rabbit pAb (A7581) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7581 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on WDR45. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to WDR45. (Distance between topics and target gene indicate popularity.) WDR45

* Data provided by citexs.com, for reference only.

Publishing research using A7581? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order