Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

WDR33 Rabbit pAb (A14208)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Rat

ABclonal:Western blot - WDR33 Rabbit pAb (A14208)

Western blot analysis of various lysates using WDR33 Rabbit pAb (A14208) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name WDR33 Rabbit pAb
Catalog No. A14208
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to be involved in mRNA polyadenylation. Predicted to act upstream of or within mRNA processing. Located in nucleus. Orthologous to human WDR33 (WD repeat domain 33).

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of mouse WDR33 (NP_001164437.1).
Sequence MATEIGSPPRFFHMPRFQHQAPRQLFYKRPDFAQQQAMQQLTFDGKRMRKAVNRKTIDYNPSVIKYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETILQAHDSPVRAMTWSHNDMWMLTADHGGYVKYWQSNMNNVKMFQAHKEAIREA
Gene ID 74320
Swiss prot
Synonyms WDC146; 1110001N06Rik; 2310011G05Rik; 2810021O11Rik; 8430413N20Rik; WDR33
Calculated MW 30kDa/38kDa/145kDa
Observed MW 145kDa

Applications

Reactivity Human, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, Rat testis
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

WDR33 Rabbit pAb images

ABclonal:Western blot - WDR33 Rabbit pAb (A14208)}

Western blot - WDR33 Rabbit pAb (A14208)

Western blot analysis of various lysates using WDR33 Rabbit pAb (A14208) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A14208 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Wdr33. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Wdr33. (Distance between topics and target gene indicate popularity.) Wdr33

* Data provided by citexs.com, for reference only.

Publishing research using A14208? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order