Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

WBP5 Rabbit pAb (A15990)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

You may also interested in:

Overview

Product name WBP5 Rabbit pAb
Catalog No. A15990
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein. This gene also encodes a domain with similarity to the transcription elongation factor A, SII-related family. Alternative splicing results in multiple transcript variants encoding a single isoform.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human WBP5 (NP_057387.1).
Sequence MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDIHNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM
Gene ID 51186
Swiss prot Q9UHQ7
Synonyms WBP5; WEX6
Calculated MW 13kDa
Observed MW Refer to figures

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location nucleus

Inquire About This Product

Submit your question about A15990 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TCEAL9. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TCEAL9. (Distance between topics and target gene indicate popularity.) TCEAL9

* Data provided by citexs.com, for reference only.

Publishing research using A15990? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order