Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

von Willebrand factor (VWF) Rabbit pAb (A1335)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - von Willebrand factor (VWF) Rabbit pAb (A1335)

Western blot analysis of lysates from ECV-304 cells, using von Willebrand factor (VWF) Rabbit pAb (A1335) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - von Willebrand factor (VWF) Rabbit pAb (A1335)

Immunohistochemistry analysis of von Willebrand factor (VWF) in paraffin-embedded human colon carcinoma using von Willebrand factor (VWF) Rabbit pAb (A1335) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - von Willebrand factor (VWF) Rabbit pAb (A1335)

Immunohistochemistry analysis of von Willebrand factor (VWF) in paraffin-embedded human esophagus using von Willebrand factor (VWF) Rabbit pAb (A1335) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name von Willebrand factor (VWF) Rabbit pAb
Catalog No. A1335
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a glycoprotein involved in hemostasis. The encoded preproprotein is proteolytically processed following assembly into large multimeric complexes. These complexes function in the adhesion of platelets to sites of vascular injury and the transport of various proteins in the blood. Mutations in this gene result in von Willebrand disease, an inherited bleeding disorder. An unprocessed pseudogene has been found on chromosome 22.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2645-2813 of human von Willebrand factor (VWF) (NP_000543.2).
Sequence LPTACTIQLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLAEGGKIMKIPGTCCDTCEEPECNDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSIDINDVQDQCSCCSPTRTEPMQVALHCTNGSVVYHEVLNAMECKCSPRKCSK
Gene ID 7450
Swiss prot P04275
Synonyms VWD; F8VWF; von Willebrand factor (VWF)
Calculated MW 309kDa
Observed MW 309kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples ECV-304
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

ICC (Rattus norvegicus)

WB (Homo sapiens, Mus musculus)

IHC (Homo sapiens, Rattus norvegicus)

IF (Gallus gallus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

von Willebrand factor (VWF) Rabbit pAb images

ABclonal:Western blot - von Willebrand factor (VWF) Rabbit pAb (A1335)}

Western blot - von Willebrand factor (VWF) Rabbit pAb (A1335)

Western blot analysis of lysates from ECV-304 cells, using von Willebrand factor (VWF) Rabbit pAb (A1335) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - von Willebrand factor (VWF) Rabbit pAb (A1335)}

Immunohistochemistry - von Willebrand factor (VWF) Rabbit pAb (A1335)

Immunohistochemistry analysis of von Willebrand factor (VWF) in paraffin-embedded human colon carcinoma using von Willebrand factor (VWF) Rabbit pAb (A1335) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - von Willebrand factor (VWF) Rabbit pAb (A1335)}

Immunohistochemistry - von Willebrand factor (VWF) Rabbit pAb (A1335)

Immunohistochemistry analysis of von Willebrand factor (VWF) in paraffin-embedded human esophagus using von Willebrand factor (VWF) Rabbit pAb (A1335) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1335 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on VWF. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to VWF. (Distance between topics and target gene indicate popularity.) VWF

* Data provided by citexs.com, for reference only.

Publishing research using A1335? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order