Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VHL Rabbit pAb (A11240)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - VHL Rabbit pAb (A11240)

Western blot analysis of various lysates using VHL Rabbit pAb (A11240) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name VHL Rabbit pAb
Catalog No. A11240
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a component of a ubiquitination complex. The encoded protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. In addition to oxygen-related gene expression, this protein plays a role in many other cellular processes including cilia formation, cytokine signaling, regulation of senescence, and formation of the extracellular matrix. Variants of this gene are associated with von Hippel-Lindau syndrome, pheochromocytoma, erythrocytosis, renal cell carcinoma, and cerebellar hemangioblastoma.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human VHL (NP_937799.1).
Sequence MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT
Gene ID 7428
Swiss prot P40337
Synonyms RCA1; VHL1; pVHL; HRCA1; VHL
Calculated MW 24kDa
Observed MW 18kDa, 24kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain, Mouse kidneyMCF-7, Raji, Mouse kidney
Cellular location Cytoplasm, Membrane, Nucleus, Nucleus, Peripheral membrane protein

Research Area

VHL Rabbit pAb images

ABclonal:Western blot - VHL Rabbit pAb (A11240)}

Western blot - VHL Rabbit pAb (A11240)

Western blot analysis of various lysates using VHL Rabbit pAb (A11240) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A11240 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on VHL. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to VHL. (Distance between topics and target gene indicate popularity.) VHL

* Data provided by citexs.com, for reference only.

Publishing research using A11240? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order