Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VEGFR1 Rabbit pAb (A1277)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - VEGFR1 Rabbit pAb (A1277)

Western blot analysis of extracts of various cell lines, using VEGFR1 antibody (A1277) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)

Immunohistochemistry analysis of paraffin-embedded rat spleen using FLT1 antibody (A1277) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)

Immunohistochemistry analysis of paraffin-embedded human placenta using FLT1 antibody (A1277) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using FLT1 antibody (A1277) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name VEGFR1 Rabbit pAb
Catalog No. A1277
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human VEGFR1 (NP_002010.2).
Sequence LTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
Gene ID 2321
Swiss prot P17948
Synonyms FLT; FLT-1; VEGFR1; VEGFR-1
Calculated MW 151kDa
Observed MW 151kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse lung, Mouse kidney, Rat lung
Cellular location Cell membrane, Cytoplasm, Endosome, Secreted, Single-pass type I membrane protein
Customer validation

WB (Gallus gallus, Homo sapiens)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

VEGFR1 Rabbit pAb images

ABclonal:Western blot - VEGFR1 Rabbit pAb (A1277)}

Western blot - VEGFR1 Rabbit pAb (A1277)

Western blot analysis of extracts of various cell lines, using VEGFR1 antibody (A1277) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)}

Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)

Immunohistochemistry analysis of paraffin-embedded rat spleen using FLT1 antibody (A1277) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)}

Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)

Immunohistochemistry analysis of paraffin-embedded human placenta using FLT1 antibody (A1277) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)}

Immunohistochemistry - VEGFR1 Rabbit pAb (A1277)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using FLT1 antibody (A1277) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1277 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FLT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FLT1. (Distance between topics and target gene indicate popularity.) FLT1

* Data provided by citexs.com, for reference only.

Publishing research using A1277? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Proteins (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order