Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

VE Cadherin Rabbit pAb (A0734)

Review (1) Publications (13) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - VE Cadherin Rabbit pAb (A0734)

Western blot analysis of extracts of HUVEC cells, using VE Cadherin antibody (A0734) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - VE Cadherin Rabbit pAb (A0734)

Western blot analysis of extracts of Mouse brain, using VE Cadherin antibody (A0734) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Review
ABclonal: review for VE Cadherin Rabbit pAb(A0734)

You may also interested in:

Overview

Product name VE Cadherin Rabbit pAb
Catalog No. A0734
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 259-358 of human VE Cadherin (NP_001786.2).
Sequence TQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQ
Gene ID 1003
Swiss prot P33151
Synonyms 7B4; CD144; VE Cadherin
Calculated MW 88kDa
Observed MW 130kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HUVEC, Mouse brain
Cellular location Cell junction, Cell membrane, Single-pass type I membrane protein
Customer validation

IF (HUVECHomo sapiens, Homo sapiens, Mus musculus)

WB (Bos taurus, Mus musculus, Homo sapiens, Sus scrofa, Xenopus laevis, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

VE Cadherin Rabbit pAb images

ABclonal:Western blot - VE Cadherin Rabbit pAb (A0734)}

Western blot - VE Cadherin Rabbit pAb (A0734)

Western blot analysis of extracts of HUVEC cells, using VE Cadherin antibody (A0734) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - VE Cadherin Rabbit pAb (A0734)}

Western blot - VE Cadherin Rabbit pAb (A0734)

Western blot analysis of extracts of Mouse brain, using VE Cadherin antibody (A0734) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

Submit an review for A0734

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0734 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDH5. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDH5. (Distance between topics and target gene indicate popularity.) CDH5

* Data provided by citexs.com, for reference only.

Publishing research using A0734? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order