Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UTP6 Rabbit pAb (A17730)

Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - UTP6 Rabbit pAb (A17730)

Western blot analysis of various lysates using UTP6 Rabbit pAb (A17730) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

You may also interested in:

Overview

Product name UTP6 Rabbit pAb
Catalog No. A17730
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable snoRNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Located in chromosome and nucleolus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human UTP6 (NP_060898.2).
Sequence MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLFKEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRASAKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEFEKASMDVENPDYSEEILKGE
Gene ID 55813
Swiss prot Q9NYH9
Synonyms HCA66; C17orf40; UTP6
Calculated MW 70kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HT-29, HeLa, Mouse lung, Mouse thymus, Mouse spleen, Rat lung, Rat thymus
Cellular location nucleolus, nucleoplasm, Pwp2p-containing subcomplex of 90S preribosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

UTP6 Rabbit pAb images

ABclonal:Western blot - UTP6 Rabbit pAb (A17730)}

Western blot - UTP6 Rabbit pAb (A17730)

Western blot analysis of various lysates using UTP6 Rabbit pAb (A17730) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Inquire About This Product

Submit your question about A17730 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UTP6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UTP6. (Distance between topics and target gene indicate popularity.) UTP6

* Data provided by citexs.com, for reference only.

Publishing research using A17730? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order