Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

USP9X/USP9Y Rabbit pAb (A20758)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - USP9X/USP9Y Rabbit pAb (A20758)

Western blot analysis of various lysates using USP9X/USP9Y Rabbit pAb (A20758) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)

Immunohistochemistry analysis of USP9X/USP9Y in paraffin-embedded rat kidney tissue using USP9X/USP9Y Rabbit pAb (A20758) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)

Immunohistochemistry analysis of USP9X/USP9Y in paraffin-embedded mouse testis tissue using USP9X/USP9Y Rabbit pAb (A20758) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)

Immunohistochemistry analysis of USP9X/USP9Y in paraffin-embedded mouse kidney tissue using USP9X/USP9Y Rabbit pAb (A20758) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of 293T cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of HepG2 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of NIH/3T3 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of PC-12 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name USP9X/USP9Y Rabbit pAb
Catalog No. A20758
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the peptidase C19 family. It encodes a protein that is similar to ubiquitin-specific proteases, which cleave the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 2456-2555 of human USP9X/USP9Y (NP_004645.2).
Sequence YFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLYPHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ
Gene ID 8287
Swiss prot O00507
Synonyms DFFRY; SPGFY2; USP9X/USP9Y
Calculated MW 291kDa
Observed MW 291kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, Mouse testis, Rat brain
Cellular location cytoplasm, cytosol, nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

USP9X/USP9Y Rabbit pAb images

ABclonal:Western blot - USP9X/USP9Y Rabbit pAb (A20758)}

Western blot - USP9X/USP9Y Rabbit pAb (A20758)

Western blot analysis of various lysates using USP9X/USP9Y Rabbit pAb (A20758) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)}

Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)

Immunohistochemistry analysis of USP9X/USP9Y in paraffin-embedded rat kidney tissue using USP9X/USP9Y Rabbit pAb (A20758) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)}

Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)

Immunohistochemistry analysis of USP9X/USP9Y in paraffin-embedded mouse testis tissue using USP9X/USP9Y Rabbit pAb (A20758) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)}

Immunohistochemistry - USP9X/USP9Y Rabbit pAb (A20758)

Immunohistochemistry analysis of USP9X/USP9Y in paraffin-embedded mouse kidney tissue using USP9X/USP9Y Rabbit pAb (A20758) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)}

Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of 293T cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)}

Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of HepG2 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)}

Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of NIH/3T3 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)}

Immunofluorescence - USP9X/USP9Y Rabbit pAb (A20758)

Immunofluorescence analysis of PC-12 cells using USP9X/USP9Y Rabbit pAb (A20758) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A20758 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on USP9Y. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to USP9Y. (Distance between topics and target gene indicate popularity.) USP9Y

* Data provided by citexs.com, for reference only.

Publishing research using A20758? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order