Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PGP9.5/UCHL1 Rabbit pAb (A0148)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - PGP9.5/UCHL1 Rabbit pAb (A0148)

Western blot analysis of extracts of various cell lines, using PGP9.5/PGP9.5/UCHL1 antibody (A0148) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

You may also interested in:

Overview

Product name PGP9.5/UCHL1 Rabbit pAb
Catalog No. A0148
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 59-223 of human PGP9.5/PGP9.5/UCHL1 (NP_004172.2).
Sequence HENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVALCKAA
Gene ID 7345
Swiss prot P09936
Synonyms NDGOA; PARK5; PGP95; SPG79; PGP9.5; SPG79A; UCHL-1; Uch-L1; HEL-117; PGP 9.5; HEL-S-53; PGP9.5/UCHL1
Calculated MW 25kDa
Observed MW 25kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples A-549, SH-SY5Y, Mouse brain
Cellular location Cytoplasm, Endoplasmic reticulum membrane, Lipid-anchor
Customer validation

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PGP9.5/UCHL1 Rabbit pAb images

ABclonal:Western blot - PGP9.5/UCHL1 Rabbit pAb (A0148)}

Western blot - PGP9.5/UCHL1 Rabbit pAb (A0148)

Western blot analysis of extracts of various cell lines, using PGP9.5/PGP9.5/UCHL1 antibody (A0148) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Inquire About This Product

Submit your question about A0148 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UCHL1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UCHL1. (Distance between topics and target gene indicate popularity.) UCHL1

* Data provided by citexs.com, for reference only.

Publishing research using A0148? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order