Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UBE2M Rabbit pAb (A9007)

Publications (2) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - UBE2M Rabbit pAb (A9007)

Western blot analysis of extracts of various cell lines, using UBE2M antibody (A9007) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name UBE2M Rabbit pAb
Catalog No. A9007
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2M (NP_003960.1).
Sequence MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Gene ID 9040
Swiss prot P61081
Synonyms UBC12; hUbc12; UBC-RS2; UBE2M
Calculated MW 21kDa
Observed MW 21kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T, Mouse kidney, Mouse heart, Mouse testis
Cellular location cytosol, nucleoplasm, nucleus
Customer validation

WB (Homo sapiens)

Research Area

UBE2M Rabbit pAb images

ABclonal:Western blot - UBE2M Rabbit pAb (A9007)}

Western blot - UBE2M Rabbit pAb (A9007)

Western blot analysis of extracts of various cell lines, using UBE2M antibody (A9007) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A9007 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UBE2M. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UBE2M. (Distance between topics and target gene indicate popularity.) UBE2M

* Data provided by citexs.com, for reference only.

Publishing research using A9007? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order