Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

UBE2G1 Rabbit pAb (A6997)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

You may also interested in:

Overview

Product name UBE2G1 Rabbit pAb
Catalog No. A6997
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human UBE2G1 (NP_003333.1).
Sequence MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Gene ID 7326
Swiss prot P62253
Synonyms UBC7; E217K; UBE2G; UBE2G1
Calculated MW 20kDa
Observed MW Refer to figures

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples
Cellular location

Research Area

Inquire About This Product

Submit your question about A6997 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on UBE2G1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to UBE2G1. (Distance between topics and target gene indicate popularity.) UBE2G1

* Data provided by citexs.com, for reference only.

Publishing research using A6997? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order