Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TYMS Rabbit pAb (A10441)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TYMS Rabbit pAb (A10441)

Western blot analysis of various lysates using TYMS Rabbit pAb (A10441) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.

ABclonal:Immunohistochemistry - TYMS Rabbit pAb (A10441)

Immunohistochemistry analysis of TYMS in paraffin-embedded human thyroid cancer using TYMS Rabbit pAb (A10441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TYMS Rabbit pAb (A10441)

Immunohistochemistry analysis of TYMS in paraffin-embedded mouse testis using TYMS Rabbit pAb (A10441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TYMS Rabbit pAb
Catalog No. A10441
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human TYMS (NP_001062.1).
Sequence MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Gene ID 7298
Swiss prot P04818
Synonyms TS; TMS; DKCD; HST422; TYMS
Calculated MW 36kDa
Observed MW 36kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples MOLT-4, HeLa, 293F, T-47D
Cellular location Cytoplasm, Mitochondrion, Mitochondrion inner membrane, Mitochondrion matrix, Nucleus
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TYMS Rabbit pAb images

ABclonal:Western blot - TYMS Rabbit pAb (A10441)}

Western blot - TYMS Rabbit pAb (A10441)

Western blot analysis of various lysates using TYMS Rabbit pAb (A10441) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 60s.
ABclonal:Immunohistochemistry - TYMS Rabbit pAb (A10441)}

Immunohistochemistry - TYMS Rabbit pAb (A10441)

Immunohistochemistry analysis of TYMS in paraffin-embedded human thyroid cancer using TYMS Rabbit pAb (A10441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TYMS Rabbit pAb (A10441)}

Immunohistochemistry - TYMS Rabbit pAb (A10441)

Immunohistochemistry analysis of TYMS in paraffin-embedded mouse testis using TYMS Rabbit pAb (A10441) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A10441 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TYMS. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TYMS. (Distance between topics and target gene indicate popularity.) TYMS

* Data provided by citexs.com, for reference only.

Publishing research using A10441? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order