Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TXNIP Rabbit pAb (A9342)

Reviews (2) Publications (12) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TXNIP Rabbit pAb (A9342)

Western blot analysis of lysates from Mouse thymus, using TXNIP Rabbit pAb (A9342) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - TXNIP Rabbit pAb (A9342)

Immunofluorescence analysis of U2OS cells using TXNIP Rabbit pAb (A9342) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TXNIP Rabbit pAb (A9342)

Immunofluorescence analysis of NIH/3T3 cells using TXNIP Rabbit pAb (A9342) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TXNIP Rabbit pAb (A9342)

Immunofluorescence analysis of PC-12 cells using TXNIP Rabbit pAb (A9342) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for TXNIP Rabbit pAb(A9342)
Review
ABclonal: review for TXNIP Rabbit pAb(A9342)

You may also interested in:

Overview

Product name TXNIP Rabbit pAb
Catalog No. A9342
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inhibits the antioxidative function of thioredoxin resulting in the accumulation of reactive oxygen species and cellular stress. This protein also functions as a regulator of cellular metabolism and of endoplasmic reticulum (ER) stress. This protein may also function as a tumor suppressor. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-166 of human TXNIP (NP_006463.3).
Sequence MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGSQQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGCVDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEK
Gene ID 10628
Swiss prot Q9H3M7
Synonyms THIF; VDUP1; ARRDC6; HHCPA78; EST01027; TXNIP
Calculated MW 44kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse thymus
Cellular location Cytoplasm
Customer validation

IF (Human bone marrow cancer cellHomo sapiens, fish, Mus musculus, Rattus norvegicus)

WB (Human chronic myeloid leukemia cellsMus musculus, Mus musculus, Homo sapiens, Gallus gallus, fish, Cyprinus carpio Linnaeus, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TXNIP Rabbit pAb images

ABclonal:Western blot - TXNIP Rabbit pAb (A9342)}

Western blot - TXNIP Rabbit pAb (A9342)

Western blot analysis of lysates from Mouse thymus, using TXNIP Rabbit pAb (A9342) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - TXNIP Rabbit pAb (A9342)}

Immunofluorescence - TXNIP Rabbit pAb (A9342)

Immunofluorescence analysis of U2OS cells using TXNIP Rabbit pAb (A9342) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TXNIP Rabbit pAb (A9342)}

Immunofluorescence - TXNIP Rabbit pAb (A9342)

Immunofluorescence analysis of NIH/3T3 cells using TXNIP Rabbit pAb (A9342) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TXNIP Rabbit pAb (A9342)}

Immunofluorescence - TXNIP Rabbit pAb (A9342)

Immunofluorescence analysis of PC-12 cells using TXNIP Rabbit pAb (A9342) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A9342

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A9342 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TXNIP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TXNIP. (Distance between topics and target gene indicate popularity.) TXNIP

* Data provided by citexs.com, for reference only.

Publishing research using A9342? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order