Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TUBB8 Rabbit pAb (A8396)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - TUBB8 Rabbit pAb (A8396)

Western blot analysis of extracts of various cell lines, using TUBB8 antibody (A8396) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - TUBB8 Rabbit pAb (A8396)

Immunofluorescence analysis of U2OS cells using TUBB8 antibody (A8396) at dilution of 1:100. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TUBB8 Rabbit pAb
Catalog No. A8396
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene represents the primary beta-tubulin subunit of oocytes and the early embryo. Defects in this gene, which is primate-specific, are a cause of oocyte maturation defect 2 and infertility.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-444 of human TUBB8 (NP_817124.1).
Sequence KTAVCDIPPRGLKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDEEYAEEEVA
Gene ID 347688
Swiss prot Q3ZCM7
Synonyms OOMD; OOMD2; OZEMA2; bA631M21.2; TUBB8
Calculated MW 50kDa
Observed MW 55kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples U-251MG, Jurkat, K-562
Cellular location Cytoplasm, cytoskeleton

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TUBB8 Rabbit pAb images

ABclonal:Western blot - TUBB8 Rabbit pAb (A8396)}

Western blot - TUBB8 Rabbit pAb (A8396)

Western blot analysis of extracts of various cell lines, using TUBB8 antibody (A8396) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunofluorescence - TUBB8 Rabbit pAb (A8396)}

Immunofluorescence - TUBB8 Rabbit pAb (A8396)

Immunofluorescence analysis of U2OS cells using TUBB8 antibody (A8396) at dilution of 1:100. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A8396 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TUBB8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TUBB8. (Distance between topics and target gene indicate popularity.) TUBB8

* Data provided by citexs.com, for reference only.

Publishing research using A8396? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order