Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] βIII-Tubulin Rabbit pAb (A17074)

KO/KDValidated

Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Western blot analysis of various lysates using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Western blot analysis of lysates from wild type (WT) and βIII-Tubulin/β3-Tubulin knockout (KO) HeLa cells, using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Immunofluorescence analysis of paraffin-embedded Mouse brain using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Immunofluorescence analysis of paraffin-embedded Rat brain using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] βIII-Tubulin Rabbit pAb
Catalog No. A17074
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a class III member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is primarily expressed in neurons and may be involved in neurogenesis and axon guidance and maintenance. Mutations in this gene are the cause of congenital fibrosis of the extraocular muscles type 3. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 6.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human βIII-Tubulin/β3-Tubulin. (NP_006077.2).
Sequence SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
Gene ID 10381
Swiss prot Q13509
Synonyms CDCBM; FEOM3; TUBB4; CDCBM1; CFEOM3; beta-4; CFEOM3A; in
Calculated MW 50kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, 293T, MCF7, mouse brain, mouse testis, rat brain, rat testis
Cellular location Cytoplasm, cytoskeleton
Customer validation

IF (Homo sapiens)

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] βIII-Tubulin Rabbit pAb images

ABclonal:Western blot - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)}

Western blot - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Western blot analysis of various lysates using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)}

Western blot - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Western blot analysis of lysates from wild type (WT) and βIII-Tubulin/β3-Tubulin knockout (KO) HeLa cells, using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)}

Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Immunofluorescence analysis of paraffin-embedded Mouse brain using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)}

Immunofluorescence - [KO Validated] βIII-Tubulin Rabbit pAb (A17074)

Immunofluorescence analysis of paraffin-embedded Rat brain using [KO Validated] βIII-Tubulin Rabbit pAb (A17074) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A17074 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TUBB3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TUBB3. (Distance between topics and target gene indicate popularity.) TUBB3

* Data provided by citexs.com, for reference only.

Publishing research using A17074? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order