Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

PBR/TSPO Rabbit pAb (A15649)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - PBR/TSPO Rabbit pAb (A15649)

Western blot analysis of various lysates, using PBR/TSPO Rabbit pAb (A15649) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunofluorescence - PBR/TSPO Rabbit pAb (A15649)

Immunofluorescence analysis of L929 cells using PBR/PBR/TSPO Polyclonal Antibody (A15649) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name PBR/TSPO Rabbit pAb
Catalog No. A15649
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-50 of human PBR/PBR/TSPO (NP_000705.2).
Sequence MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLG
Gene ID 706
Swiss prot P30536
Synonyms DBI; IBP; MBR; PBR; PBS; BPBS; BZRP; PKBS; PTBR; mDRC; pk18; TSPO1; PBR/TSPO
Calculated MW 19kDa
Observed MW 19kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Mouse kidney
Cellular location Mitochondrion membrane, Multi-pass membrane protein
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

PBR/TSPO Rabbit pAb images

ABclonal:Western blot - PBR/TSPO Rabbit pAb (A15649)}

Western blot - PBR/TSPO Rabbit pAb (A15649)

Western blot analysis of various lysates, using PBR/TSPO Rabbit pAb (A15649) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunofluorescence - PBR/TSPO Rabbit pAb (A15649)}

Immunofluorescence - PBR/TSPO Rabbit pAb (A15649)

Immunofluorescence analysis of L929 cells using PBR/PBR/TSPO Polyclonal Antibody (A15649) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A15649 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TSPO. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TSPO. (Distance between topics and target gene indicate popularity.) TSPO

* Data provided by citexs.com, for reference only.

Publishing research using A15649? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order