Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TSG101/VPS23 Rabbit pAb (A1692)

Review (1) Publications (30) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TSG101/VPS23 Rabbit pAb (A1692)

Western blot analysis of lysates from wild type (WT) and TSG101/VPS23 knockdown (KD) SH-SY5Y cells using TSG101/VPS23 Rabbit pAb (A1692) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 120s.

ABclonal:Western blot - TSG101/VPS23 Rabbit pAb (A1692)

Western blot analysis of lysates from K-562 cells using TSG101/VPS23 Rabbit pAb(A1692) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:120s.

ABclonal:Immunofluorescence - TSG101/VPS23 Rabbit pAb (A1692)

Immunofluorescence analysis of Jurkat cells using TSG101/VPS23 Rabbit pAb (A1692) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TSG101/VPS23 Rabbit pAb (A1692)

Immunofluorescence analysis of PC-12 cells using TSG101/VPS23 Rabbit pAb (A1692) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for TSG101/VPS23 Rabbit pAb(A1692)

You may also interested in:

Overview

Product name TSG101/VPS23 Rabbit pAb
Catalog No. A1692
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1).
Sequence LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
Gene ID 7251
Swiss prot Q99816
Synonyms TSG10; VPS23; TSG101/VPS23
Calculated MW 44kDa
Observed MW 44kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples SH-SY5Y, K-562
Cellular location Cytoplasm, Late endosome membrane, Membrane, Nucleus, Peripheral membrane protein
Customer validation

WB (HEK293TCynoglossus semilaevis, Rattus norvegicus, Homo sapiens, Mus musculus, Gallus gallus)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TSG101/VPS23 Rabbit pAb images

ABclonal:Western blot - TSG101/VPS23 Rabbit pAb (A1692)}

Western blot - TSG101/VPS23 Rabbit pAb (A1692)

Western blot analysis of lysates from wild type (WT) and TSG101/VPS23 knockdown (KD) SH-SY5Y cells using TSG101/VPS23 Rabbit pAb (A1692) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 120s.
ABclonal:Western blot - TSG101/VPS23 Rabbit pAb (A1692)}

Western blot - TSG101/VPS23 Rabbit pAb (A1692)

Western blot analysis of lysates from K-562 cells using TSG101/VPS23 Rabbit pAb(A1692) at 1:500 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:120s.
ABclonal:Immunofluorescence - TSG101/VPS23 Rabbit pAb (A1692)}

Immunofluorescence - TSG101/VPS23 Rabbit pAb (A1692)

Immunofluorescence analysis of Jurkat cells using TSG101/VPS23 Rabbit pAb (A1692) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TSG101/VPS23 Rabbit pAb (A1692)}

Immunofluorescence - TSG101/VPS23 Rabbit pAb (A1692)

Immunofluorescence analysis of PC-12 cells using TSG101/VPS23 Rabbit pAb (A1692) at dilution of 1:50 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A1692

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1692 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TSG101. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TSG101. (Distance between topics and target gene indicate popularity.) TSG101

* Data provided by citexs.com, for reference only.

Publishing research using A1692? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order