Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TRPC7 Rabbit pAb (A17738)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TRPC7 Rabbit pAb (A17738)

Western blot analysis of various lysates using TRPC7 Rabbit pAb (A17738) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name TRPC7 Rabbit pAb
Catalog No. A17738
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable inositol 1, 4, 5 trisphosphate binding activity and store-operated calcium channel activity. Predicted to be involved in metal ion transport; regulation of cytosolic calcium ion concentration; and single fertilization. Predicted to act upstream of or within calcium ion transport. Predicted to be located in plasma membrane. Predicted to be part of cation channel complex. Predicted to be integral component of plasma membrane.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1).
Sequence YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
Gene ID 57113
Swiss prot Q9HCX4
Synonyms TRP7; TRPC7
Calculated MW 100kDa
Observed MW 110kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, U-251MG, SH-SY5Y, A-549, 293T, Mouse lung
Cellular location cis-Golgi network, nuclear envelope, perinuclear region of cytoplasm, plasma membrane

Research Area

TRPC7 Rabbit pAb images

ABclonal:Western blot - TRPC7 Rabbit pAb (A17738)}

Western blot - TRPC7 Rabbit pAb (A17738)

Western blot analysis of various lysates using TRPC7 Rabbit pAb (A17738) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A17738 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TRPC7. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TRPC7. (Distance between topics and target gene indicate popularity.) TRPC7

* Data provided by citexs.com, for reference only.

Publishing research using A17738? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order