Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TRAF4 Rabbit pAb (A7047)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TRAF4 Rabbit pAb (A7047)

Western blot analysis of extracts of various cell lines, using TRAF4 antibody (A7047) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded human esophagus using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded human tonsil using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded mouse liver using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded rat kidney using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded rat spleen using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TRAF4 Rabbit pAb (A7047)

Immunofluorescence analysis of A549 cells using TRAF4 antibody (A7047).

You may also interested in:

Overview

Product name TRAF4 Rabbit pAb
Catalog No. A7047
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the TNF receptor associated factor (TRAF) family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. The encoded protein has been shown to interact with neurotrophin receptor, p75 (NTR/NTSR1), and negatively regulate NTR induced cell death and NF-kappa B activation. This protein has been found to bind to p47phox, a cytosolic regulatory factor included in a multi-protein complex known as NAD(P)H oxidase. This protein thus, is thought to be involved in the oxidative activation of MAPK8/JNK. Alternatively spliced transcript variants have been observed but the full-length nature of only one has been determined.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 251-470 of human TRAF4 (NP_004286.2).
Sequence PFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS
Gene ID 9618
Swiss prot Q9BUZ4
Synonyms CART1; MLN62; RNF83; TRAF4
Calculated MW 54kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples MCF7, Mouse liver
Cellular location Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Nucleus, Peripheral membrane protein, cytoskeleton, perinuclear region, tight junction

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TRAF4 Rabbit pAb images

ABclonal:Western blot - TRAF4 Rabbit pAb (A7047)}

Western blot - TRAF4 Rabbit pAb (A7047)

Western blot analysis of extracts of various cell lines, using TRAF4 antibody (A7047) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded human esophagus using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded human tonsil using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded mouse liver using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded mouse spleen using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded rat kidney using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TRAF4 Rabbit pAb (A7047)}

Immunohistochemistry - TRAF4 Rabbit pAb (A7047)

Immunohistochemistry analysis of paraffin-embedded rat spleen using TRAF4 Rabbit pAb (A7047) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - TRAF4 Rabbit pAb (A7047)}

Immunofluorescence - TRAF4 Rabbit pAb (A7047)

Immunofluorescence analysis of A549 cells using TRAF4 antibody (A7047).

Inquire About This Product

Submit your question about A7047 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TRAF4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TRAF4. (Distance between topics and target gene indicate popularity.) TRAF4

* Data provided by citexs.com, for reference only.

Publishing research using A7047? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order