Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DNA topoisomerase II alpha (TOP2A) Rabbit pAb (A16440)

Publications (5) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - DNA topoisomerase II alpha (TOP2A) Rabbit pAb (A16440)

Western blot analysis of extracts of various cell lines, using DNA topoisomerase II alpha (TOP2A) antibody (A16440) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name DNA topoisomerase II alpha (TOP2A) Rabbit pAb
Catalog No. A16440
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human DNA topoisomerase II alpha (TOP2A) (NP_001058.2).
Sequence EEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
Gene ID 7153
Swiss prot P11388
Synonyms TOP2; TP2A; TOPIIA; TOP2alpha; DNA topoisomerase II alpha (TOP2A)
Calculated MW 174kDa
Observed MW 190kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, 293T
Cellular location Cytoplasm, Nucleus, nucleoplasm
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DNA topoisomerase II alpha (TOP2A) Rabbit pAb images

ABclonal:Western blot - DNA topoisomerase II alpha (TOP2A) Rabbit pAb (A16440)}

Western blot - DNA topoisomerase II alpha (TOP2A) Rabbit pAb (A16440)

Western blot analysis of extracts of various cell lines, using DNA topoisomerase II alpha (TOP2A) antibody (A16440) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A16440 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TOP2A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TOP2A. (Distance between topics and target gene indicate popularity.) TOP2A

* Data provided by citexs.com, for reference only.

Publishing research using A16440? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order