Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

DNA topoisomerase I (TOP1) Rabbit pAb (A7741)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - DNA topoisomerase I (TOP1) Rabbit pAb (A7741)

Western blot analysis of various lysates using DNA topoisomerase I (TOP1) Rabbit pAb (A7741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name DNA topoisomerase I (TOP1) Rabbit pAb
Catalog No. A7741
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1).
Sequence MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Gene ID 7150
Swiss prot P11387
Synonyms TOPI; DNA topoisomerase I (TOP1)
Calculated MW 91kDa
Observed MW 108kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples MCF7, SKOV3, SW480, Jurkat, HeLa, Mouse spleen, Mouse ovary, Mouse testis
Cellular location Nucleus, nucleolus, nucleoplasm
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

DNA topoisomerase I (TOP1) Rabbit pAb images

ABclonal:Western blot - DNA topoisomerase I (TOP1) Rabbit pAb (A7741)}

Western blot - DNA topoisomerase I (TOP1) Rabbit pAb (A7741)

Western blot analysis of various lysates using DNA topoisomerase I (TOP1) Rabbit pAb (A7741) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A7741 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TOP1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TOP1. (Distance between topics and target gene indicate popularity.) TOP1

* Data provided by citexs.com, for reference only.

Publishing research using A7741? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order