Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNNC2 Rabbit pAb (A7740)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TNNC2 Rabbit pAb (A7740)

Western blot analysis of extracts of various cell lines, using TNNC2 antibody (A7740) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.

ABclonal:Immunohistochemistry - TNNC2 Rabbit pAb (A7740)

Immunohistochemistry analysis of paraffin-embedded human colon using TNNC2 antibody (A7740) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TNNC2 Rabbit pAb (A7740)

Immunohistochemistry analysis of paraffin-embedded mouse lung using TNNC2 antibody (A7740) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TNNC2 Rabbit pAb
Catalog No. A7740
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC2 (NP_003270.1).
Sequence MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Gene ID 7125
Swiss prot P02585
Synonyms FAP85; CFAP85; CMYP15; MYONRI; TNNC2
Calculated MW 18kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples U-937, HT-29, Mouse brain
Cellular location cytosol

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNNC2 Rabbit pAb images

ABclonal:Western blot - TNNC2 Rabbit pAb (A7740)}

Western blot - TNNC2 Rabbit pAb (A7740)

Western blot analysis of extracts of various cell lines, using TNNC2 antibody (A7740) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.
ABclonal:Immunohistochemistry - TNNC2 Rabbit pAb (A7740)}

Immunohistochemistry - TNNC2 Rabbit pAb (A7740)

Immunohistochemistry analysis of paraffin-embedded human colon using TNNC2 antibody (A7740) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TNNC2 Rabbit pAb (A7740)}

Immunohistochemistry - TNNC2 Rabbit pAb (A7740)

Immunohistochemistry analysis of paraffin-embedded mouse lung using TNNC2 antibody (A7740) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A7740 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNNC2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNNC2. (Distance between topics and target gene indicate popularity.) TNNC2

* Data provided by citexs.com, for reference only.

Publishing research using A7740? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order