Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNFSF10 Rabbit pAb (A2138)

Reviews (2) Publications (3) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - TNFSF10 Rabbit pAb (A2138)

Western blot analysis of extracts of THP-1 cells, using (A2138) at 1:1000 dilution.THP-1 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Review
ABclonal: review for TNFSF10 Rabbit pAb(A2138)
Review
ABclonal: review for TNFSF10 Rabbit pAb(A2138)

You may also interested in:

Overview

Product name TNFSF10 Rabbit pAb
Catalog No. A2138
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TNFSF10 (NP_003801.1).
Sequence MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETI
Gene ID 8743
Swiss prot P50591
Synonyms TL2; APO2L; CD253; TANCR; TRAIL; Apo-2L; TNLG6A; TNFSF10
Calculated MW 33kDa
Observed MW 28kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples THP-1
Cellular location Membrane, Single-pass type II membrane protein
Customer validation

IHC (HeLa cellsHomo sapiens)

WB (HeLa cellsHomo sapiens, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TNFSF10 Rabbit pAb images

ABclonal:Western blot - TNFSF10 Rabbit pAb (A2138)}

Western blot - TNFSF10 Rabbit pAb (A2138)

Western blot analysis of extracts of THP-1 cells, using (A2138) at 1:1000 dilution.THP-1 cells were treated by LPS (1 μg/ml) at 37℃ for 8 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Submit an review for A2138

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2138 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNFSF10. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNFSF10. (Distance between topics and target gene indicate popularity.) TNFSF10

* Data provided by citexs.com, for reference only.

Publishing research using A2138? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order