Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TNFR1/TNFRSF1A Rabbit pAb (A0033)

Publications (2) Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

You may also interested in:

Overview

Product name TNFR1/TNFRSF1A Rabbit pAb
Catalog No. A0033
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mutations in this gene underlie tumor necrosis factor receptor-associated periodic syndrome (TRAPS), characterized by fever, abdominal pain and other features. Mutations in this gene may also be associated with multiple sclerosis in human patients.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 241-455 of human TNFR1/TNFR1/TNFRSF1A (NP_001056.1).
Sequence SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
Gene ID 7132
Swiss prot P19438
Synonyms FPF; p55; p60; TBP1; TNF-R; TNFAR; TNFR1; p55-R; CD120a; TNFR55; TNFR60; TNF-R-I; TNF-R55; TNFR1/TNFRSF1A
Calculated MW 50kDa
Observed MW

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key
Positive samples
Cellular location Cell membrane, Golgi apparatus membrane, Secreted, Secreted, Single-pass type I membrane protein
Customer validation

IF (Homo sapiens)

WB (Homo sapiens)

Research Area

Inquire About This Product

Submit your question about A0033 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TNFRSF1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TNFRSF1A. (Distance between topics and target gene indicate popularity.) TNFRSF1A

* Data provided by citexs.com, for reference only.

Publishing research using A0033? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (2)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order