Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TMC1 Rabbit pAb (A8595)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TMC1 Rabbit pAb (A8595)

Western blot analysis of extracts of mouse eye, using TMC1 antibody (A8595) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunohistochemistry - TMC1 Rabbit pAb (A8595)

Immunohistochemistry analysis of paraffin-embedded rat brain using TMC1 antibody (A8595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TMC1 Rabbit pAb (A8595)

Immunohistochemistry analysis of paraffin-embedded human prostate using TMC1 antibody (A8595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TMC1 Rabbit pAb (A8595)

Immunohistochemistry analysis of paraffin-embedded human esophagus using TMC1 antibody (A8595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TMC1 Rabbit pAb
Catalog No. A8595
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, it is known to be required for normal function of cochlear hair cells. Mutations in this gene have been associated with progressive postlingual hearing loss and profound prelingual deafness.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human TMC1 (NP_619636.2).
Sequence INILRLHTSMYFQCWAVMCCNVPEARVFKASRSNNFYLGMLLLILFLSTMPVLYMIVSLPPSFDCGPFSGKNRMFEVIGETLEHDFPSWMAKILRQLSNPG
Gene ID 117531
Swiss prot Q8TDI8
Synonyms DFNB7; DFNA36; DFNB11; TMC1
Calculated MW 88kDa
Observed MW 88kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse eye
Cellular location Membrane, Multi-pass membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

TMC1 Rabbit pAb images

ABclonal:Western blot - TMC1 Rabbit pAb (A8595)}

Western blot - TMC1 Rabbit pAb (A8595)

Western blot analysis of extracts of mouse eye, using TMC1 antibody (A8595) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.
ABclonal:Immunohistochemistry - TMC1 Rabbit pAb (A8595)}

Immunohistochemistry - TMC1 Rabbit pAb (A8595)

Immunohistochemistry analysis of paraffin-embedded rat brain using TMC1 antibody (A8595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TMC1 Rabbit pAb (A8595)}

Immunohistochemistry - TMC1 Rabbit pAb (A8595)

Immunohistochemistry analysis of paraffin-embedded human prostate using TMC1 antibody (A8595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TMC1 Rabbit pAb (A8595)}

Immunohistochemistry - TMC1 Rabbit pAb (A8595)

Immunohistochemistry analysis of paraffin-embedded human esophagus using TMC1 antibody (A8595) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A8595 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TMC1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TMC1. (Distance between topics and target gene indicate popularity.) TMC1

* Data provided by citexs.com, for reference only.

Publishing research using A8595? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order