Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TLR4 Rabbit pAb (A5258)

Reviews (5) Publications (94) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TLR4 Rabbit pAb (A5258)

Western blot analysis of various lysates, using TLR4 Rabbit pAb (A5258) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Western blot - TLR4 Rabbit pAb (A5258)

Western blot analysis of lysates from Mouse liver, using TLR4 Rabbit pAb (A5258) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunofluorescence - TLR4 Rabbit pAb (A5258)

Immunofluorescence analysis of RAW264.7 cells using TLR4 Rabbit pAb (A5258) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TLR4 Rabbit pAb (A5258)

Immunofluorescence analysis of HepG2 cells using TLR4 Rabbit pAb (A5258) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TLR4 Rabbit pAb (A5258)

Immunofluorescence analysis of THP-1 cells using TLR4 Rabbit pAb (A5258) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for TLR4 Rabbit pAb(A5258)
Review
ABclonal: review for TLR4 Rabbit pAb(A5258)
Review
ABclonal: review for TLR4 Rabbit pAb(A5258)
Review
ABclonal: review for TLR4 Rabbit pAb(A5258)
Review
ABclonal: review for TLR4 Rabbit pAb(A5258)

You may also interested in:

Overview

Product name TLR4 Rabbit pAb
Catalog No. A5258
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. In silico studies have found a particularly strong binding of surface TLR4 with the spike protein of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), the causative agent of Coronavirus disease-2019 (COVID-19). This receptor has also been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness, and with susceptibility to age-related macular degeneration. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-228 of human TLR4 (NP_612564.1).
Sequence EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRL
Gene ID 7099
Swiss prot O00206
Synonyms TOLL; CD284; TLR-4; ARMD10; TLR4
Calculated MW 96kDa
Observed MW 100-135kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, Mouse liver
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

WB (Raw264.7, Rat spinal cord, Mouse cells, BV2Mus musculus, Rattus norvegicus, Mus musculus, Homo sapiens, Sus scrofa, King Charles Spaniel, Anatinae)

IHC (Mouse kidneyMus musculus, Mus musculus, Homo sapiens, Rattus norvegicus)

IF (Mus musculus, Homo sapiens)

FC (Homo sapiens)

IB (Homo sapiens)

IF/ICC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TLR4 Rabbit pAb images

ABclonal:Western blot - TLR4 Rabbit pAb (A5258)}

Western blot - TLR4 Rabbit pAb (A5258)

Western blot analysis of various lysates, using TLR4 Rabbit pAb (A5258) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Western blot - TLR4 Rabbit pAb (A5258)}

Western blot - TLR4 Rabbit pAb (A5258)

Western blot analysis of lysates from Mouse liver, using TLR4 Rabbit pAb (A5258) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
ABclonal:Immunofluorescence - TLR4 Rabbit pAb (A5258)}

Immunofluorescence - TLR4 Rabbit pAb (A5258)

Immunofluorescence analysis of RAW264.7 cells using TLR4 Rabbit pAb (A5258) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TLR4 Rabbit pAb (A5258)}

Immunofluorescence - TLR4 Rabbit pAb (A5258)

Immunofluorescence analysis of HepG2 cells using TLR4 Rabbit pAb (A5258) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TLR4 Rabbit pAb (A5258)}

Immunofluorescence - TLR4 Rabbit pAb (A5258)

Immunofluorescence analysis of THP-1 cells using TLR4 Rabbit pAb (A5258) at dilution of 1:200 (40x lens).Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A5258

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5258 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TLR4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TLR4. (Distance between topics and target gene indicate popularity.) TLR4

* Data provided by citexs.com, for reference only.

Publishing research using A5258? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order