Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TIMM17A Rabbit pAb (A6449)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TIMM17A Rabbit pAb (A6449)

Western blot analysis of extracts of various cell lines, using TIMM17A antibody (A6449) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name TIMM17A Rabbit pAb
Catalog No. A6449
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to contribute to protein transmembrane transporter activity. Predicted to be involved in protein import into mitochondrial matrix. Located in mitochondrial inner membrane and nucleoplasm. Is integral component of mitochondrial inner membrane. Part of TIM23 mitochondrial import inner membrane translocase complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-171 of human TIMM17A (NP_006326.1).
Sequence MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
Gene ID 10440
Swiss prot Q99595
Synonyms TIM17; TIM17A; TIMM17A
Calculated MW 18kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, A-549, Mouse heart, NCI-H460, MCF7, HT-29, Mouse kidney
Cellular location Mitochondrion inner membrane, Multi-pass membrane protein
Customer validation

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TIMM17A Rabbit pAb images

ABclonal:Western blot - TIMM17A Rabbit pAb (A6449)}

Western blot - TIMM17A Rabbit pAb (A6449)

Western blot analysis of extracts of various cell lines, using TIMM17A antibody (A6449) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A6449 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TIMM17A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TIMM17A. (Distance between topics and target gene indicate popularity.) TIMM17A

* Data provided by citexs.com, for reference only.

Publishing research using A6449? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order