Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TRIF/TICAM1 Rabbit pAb (A13605)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TRIF/TICAM1 Rabbit pAb (A13605)

Western blot analysis of extracts of various cell lines, using TRIF/TICAM1 Rabbit pAb (A13605) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name TRIF/TICAM1 Rabbit pAb
Catalog No. A13605
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. This protein is involved in native immunity against invading pathogens. It specifically interacts with toll-like receptor 3, but not with other TLRs, and this association mediates dsRNA induction of interferon-beta through activation of nuclear factor kappa-B, during an antiviral immune response. Mutations in this gene are associated with encephalopathy, acute, infection-induced.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human TRIF/TICAM1 (NP_891549.1).
Sequence QDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSP
Gene ID 148022
Swiss prot Q8IUC6
Synonyms TRIF; IIAE6; MyD88-3; PRVTIRB; TICAM-1; TRIF/TICAM1
Calculated MW 76kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Raji, Mouse spleen, Mouse eye, Rat spleen
Cellular location Cytoplasmic vesicle, autophagosome

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TRIF/TICAM1 Rabbit pAb images

ABclonal:Western blot - TRIF/TICAM1 Rabbit pAb (A13605)}

Western blot - TRIF/TICAM1 Rabbit pAb (A13605)

Western blot analysis of extracts of various cell lines, using TRIF/TICAM1 Rabbit pAb (A13605) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A13605 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TICAM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TICAM1. (Distance between topics and target gene indicate popularity.) TICAM1

* Data provided by citexs.com, for reference only.

Publishing research using A13605? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order