Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TGF beta 1 Rabbit pAb (A16640)

Publications (14) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Immunofluorescence - TGF beta 1 Rabbit pAb (A16640)

Immunofluorescence analysis of U2OS cells using TGF beta 1 Rabbit pAb (A16640) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TGF beta 1 Rabbit pAb
Catalog No. A16640
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGFB family members. This encoded protein regulates cell proliferation, differentiation and growth, and can modulate expression and activation of other growth factors including interferon gamma and tumor necrosis factor alpha. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TGF beta 1 (NP_000651.3).
Sequence KNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Gene ID 7040
Swiss prot P01137
Synonyms CED; LAP; DPD1; TGFB; IBDIMDE; TGFbeta; TGF-beta1; TGF beta 1
Calculated MW 44kDa
Observed MW 12kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse spleen
Cellular location Secreted, extracellular matrix, extracellular space
Customer validation

IHC (Rattus norvegicus, A. annua, Mus musculus)

WB (Homo sapiens, Mus musculus, Ovis aries, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TGF beta 1 Rabbit pAb images

ABclonal:Immunofluorescence - TGF beta 1 Rabbit pAb (A16640)}

Immunofluorescence - TGF beta 1 Rabbit pAb (A16640)

Immunofluorescence analysis of U2OS cells using TGF beta 1 Rabbit pAb (A16640) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A16640 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TGFB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TGFB1. (Distance between topics and target gene indicate popularity.) TGFB1

* Data provided by citexs.com, for reference only.

Publishing research using A16640? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

Proteins (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order