Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TFCP2L1 Rabbit pAb (A12140)

Datasheet

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - TFCP2L1 Rabbit pAb (A12140)

Western blot analysis of extracts of various cell lines, using TFCP2L1 antibody (A12140) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name TFCP2L1 Rabbit pAb
Catalog No. A12140
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm and membrane. Predicted to be part of chromatin. Predicted to be active in nucleus.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human TFCP2L1 (NP_055368.1).
Sequence NAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIH
Gene ID 29842
Swiss prot Q9NZI6
Synonyms LBP9; CRTR1; LBP-9; TFCP2L1
Calculated MW 55kDa
Observed MW 58kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 22Rv1, SGC-7901
Cellular location Nucleus

Research Area

TFCP2L1 Rabbit pAb images

ABclonal:Western blot - TFCP2L1 Rabbit pAb (A12140)}

Western blot - TFCP2L1 Rabbit pAb (A12140)

Western blot analysis of extracts of various cell lines, using TFCP2L1 antibody (A12140) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A12140 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TFCP2L1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TFCP2L1. (Distance between topics and target gene indicate popularity.) TFCP2L1

* Data provided by citexs.com, for reference only.

Publishing research using A12140? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order