Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TFAM Rabbit pAb (A1926)

Reviews (3) Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - TFAM Rabbit pAb (A1926)

Western blot analysis of extracts of various cell lines, using TFAM antibody (A1926) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunofluorescence - TFAM Rabbit pAb (A1926)

Immunofluorescence analysis of U2OS cells using TFAM antibody (A1926). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - TFAM Rabbit pAb (A1926)

Confocal immunofluorescence analysis of U2OS cells using TFAM Polyclonal Antibody (A1926) at dilution of 1:100. Blue: DAPI for nuclear staining.

Review
ABclonal: review for TFAM Rabbit pAb(A1926)
Review
ABclonal: review for TFAM Rabbit pAb(A1926)
Review
ABclonal: review for TFAM Rabbit pAb(A1926)

You may also interested in:

Overview

Product name TFAM Rabbit pAb
Catalog No. A1926
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human TFAM (NP_003192.1).
Sequence MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEE
Gene ID 7019
Swiss prot Q00059
Synonyms TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15; TFAM
Calculated MW 29kDa
Observed MW 22kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples SW620, CEM, HepG2, HT-29
Cellular location Mitochondrion, Mitochondrion matrix, mitochondrion nucleoid
Customer validation

WB (769-P;769-P TFAM OE, HK2Homo sapiens, Homo sapiens, Mus musculus)

IF (Mouse kidneyMus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TFAM Rabbit pAb images

ABclonal:Western blot - TFAM Rabbit pAb (A1926)}

Western blot - TFAM Rabbit pAb (A1926)

Western blot analysis of extracts of various cell lines, using TFAM antibody (A1926) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunofluorescence - TFAM Rabbit pAb (A1926)}

Immunofluorescence - TFAM Rabbit pAb (A1926)

Immunofluorescence analysis of U2OS cells using TFAM antibody (A1926). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - TFAM Rabbit pAb (A1926)}

Immunofluorescence - TFAM Rabbit pAb (A1926)

Confocal immunofluorescence analysis of U2OS cells using TFAM Polyclonal Antibody (A1926) at dilution of 1:100. Blue: DAPI for nuclear staining.

Submit an review for A1926

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1926 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TFAM. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TFAM. (Distance between topics and target gene indicate popularity.) TFAM

* Data provided by citexs.com, for reference only.

Publishing research using A1926? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order