Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TET3 Rabbit pAb (A7612)

Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TET3 Rabbit pAb (A7612)

Western blot analysis of various lysates using TET3 Rabbit pAb (A7612) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.

ABclonal:Immunohistochemistry - TET3 Rabbit pAb (A7612)

Immunohistochemistry analysis of TET3 in paraffin-embedded human esophageal using TET3 Rabbit pAb (A7612) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TET3 Rabbit pAb (A7612)

Immunofluorescence analysis of U2OS cells using TET3 Rabbit pAb (A7612) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TET3 Rabbit pAb
Catalog No. A7612
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables methyl-CpG binding activity and zinc ion binding activity. Involved in histone H3-K4 trimethylation; positive regulation of transcription by RNA polymerase II; and protein O-linked glycosylation. Predicted to be located in cytoplasm and male pronucleus. Predicted to be active in nucleus. Biomarker of esophagus squamous cell carcinoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1551-1650 of human TET3 (NP_001274420.1).
Sequence GFQDKLWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDEN
Gene ID 200424
Swiss prot O43151
Synonyms BEFAHRS; hCG_40738; TET3
Calculated MW 194kDa
Observed MW 179kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HL-60, SH-SY5Y, MCF7, Mouse liver
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Mus musculus, Rattus norvegicus)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TET3 Rabbit pAb images

ABclonal:Western blot - TET3 Rabbit pAb (A7612)}

Western blot - TET3 Rabbit pAb (A7612)

Western blot analysis of various lysates using TET3 Rabbit pAb (A7612) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 5s.
ABclonal:Immunohistochemistry - TET3 Rabbit pAb (A7612)}

Immunohistochemistry - TET3 Rabbit pAb (A7612)

Immunohistochemistry analysis of TET3 in paraffin-embedded human esophageal using TET3 Rabbit pAb (A7612) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - TET3 Rabbit pAb (A7612)}

Immunofluorescence - TET3 Rabbit pAb (A7612)

Immunofluorescence analysis of U2OS cells using TET3 Rabbit pAb (A7612) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7612 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TET3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TET3. (Distance between topics and target gene indicate popularity.) TET3

* Data provided by citexs.com, for reference only.

Publishing research using A7612? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

!OUT OF STOCK

See Below for Alternatives
Contact us to order