Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TET1 Rabbit pAb (A1506)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TET1 Rabbit pAb (A1506)

Western blot analysis of various lysates using TET1 Rabbit pAb (A1506) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - TET1 Rabbit pAb (A1506)

Immunohistochemistry analysis of TET1 in paraffin-embedded mouse fetal Brain using TET1 Rabbit pAb (A1506) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - TET1 Rabbit pAb (A1506)

Immunofluorescence analysis of HeLa cells using TET1 Rabbit pAb (A1506) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name TET1 Rabbit pAb
Catalog No. A1506
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

DNA methylation is an epigenetic mechanism that is important for controlling gene expression. The protein encoded by this gene is a demethylase that belongs to the TET (ten-eleven translocation) family. Members of the TET protein family play a role in the DNA methylation process and gene activation.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1800-1900 of human TET1 (NP_085128.2).
Sequence TLGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPGFSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAADGPG
Gene ID 80312
Swiss prot Q8NFU7
Synonyms LCX; CXXC6; bA119F7.1; TET1
Calculated MW 235kDa
Observed MW 250kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Neuro-2a, Rat heart
Cellular location Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

IF (Homo sapiens)

IHC (Mus musculus)

RT-qPCR (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TET1 Rabbit pAb images

ABclonal:Western blot - TET1 Rabbit pAb (A1506)}

Western blot - TET1 Rabbit pAb (A1506)

Western blot analysis of various lysates using TET1 Rabbit pAb (A1506) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - TET1 Rabbit pAb (A1506)}

Immunohistochemistry - TET1 Rabbit pAb (A1506)

Immunohistochemistry analysis of TET1 in paraffin-embedded mouse fetal Brain using TET1 Rabbit pAb (A1506) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - TET1 Rabbit pAb (A1506)}

Immunofluorescence - TET1 Rabbit pAb (A1506)

Immunofluorescence analysis of HeLa cells using TET1 Rabbit pAb (A1506) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A1506 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TET1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TET1. (Distance between topics and target gene indicate popularity.) TET1

* Data provided by citexs.com, for reference only.

Publishing research using A1506? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order