Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TCEB2 Rabbit pAb (A5362)

Review (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - TCEB2 Rabbit pAb (A5362)

Western blot analysis of various lysates using TCEB2 Rabbit pAb (A5362) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunoprecipitation - TCEB2 Rabbit pAb (A5362)

Immunoprecipitation analysis of 150 μg extracts of MCF7 cells using 3 μg TCEB2 antibody (A5362). Western blot was performed from the immunoprecipitate using TCEB2 antibody (A5362) at a dilution of 1:500.

Review
ABclonal: review for TCEB2 Rabbit pAb(A5362)

You may also interested in:

Overview

Product name TCEB2 Rabbit pAb
Catalog No. A5362
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human TCEB2 (NP_009039.1).
Sequence MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
Gene ID 6923
Swiss prot Q15370
Synonyms SIII; TCEB2
Calculated MW 13kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples 22Rv1, NCI-H460, HL-60, SKOV3, MCF7, U-251MG, Mouse eye, Mouse intestine, Mouse kidney
Cellular location Nucleus
Customer validation

WB (HeLa)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TCEB2 Rabbit pAb images

ABclonal:Western blot - TCEB2 Rabbit pAb (A5362)}

Western blot - TCEB2 Rabbit pAb (A5362)

Western blot analysis of various lysates using TCEB2 Rabbit pAb (A5362) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunoprecipitation - TCEB2 Rabbit pAb (A5362)}

Immunoprecipitation - TCEB2 Rabbit pAb (A5362)

Immunoprecipitation analysis of 150 μg extracts of MCF7 cells using 3 μg TCEB2 antibody (A5362). Western blot was performed from the immunoprecipitate using TCEB2 antibody (A5362) at a dilution of 1:500.

Submit an review for A5362

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A5362 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ELOB. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ELOB. (Distance between topics and target gene indicate popularity.) ELOB

* Data provided by citexs.com, for reference only.

Publishing research using A5362? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order