Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TCEB1 Rabbit pAb (A1989)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TCEB1 Rabbit pAb (A1989)

Western blot analysis of extracts of various cell lines, using TCEB1 antibody (A1989) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - TCEB1 Rabbit pAb (A1989)

Immunohistochemistry analysis of paraffin-embedded mouse liver using TCEB1 antibody (A1989) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TCEB1 Rabbit pAb (A1989)

Immunohistochemistry analysis of paraffin-embedded human prostate using TCEB1 antibody (A1989) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TCEB1 Rabbit pAb
Catalog No. A1989
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-112 of human TCEB1 (NP_001191791.1).
Sequence MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Gene ID 6921
Swiss prot Q15369
Synonyms SIII; TCEB1
Calculated MW 12kDa
Observed MW 12kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat, HepG2, Mouse testis, Mouse brain
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TCEB1 Rabbit pAb images

ABclonal:Western blot - TCEB1 Rabbit pAb (A1989)}

Western blot - TCEB1 Rabbit pAb (A1989)

Western blot analysis of extracts of various cell lines, using TCEB1 antibody (A1989) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
ABclonal:Immunohistochemistry - TCEB1 Rabbit pAb (A1989)}

Immunohistochemistry - TCEB1 Rabbit pAb (A1989)

Immunohistochemistry analysis of paraffin-embedded mouse liver using TCEB1 antibody (A1989) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TCEB1 Rabbit pAb (A1989)}

Immunohistochemistry - TCEB1 Rabbit pAb (A1989)

Immunohistochemistry analysis of paraffin-embedded human prostate using TCEB1 antibody (A1989) (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1989 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ELOC. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ELOC. (Distance between topics and target gene indicate popularity.) ELOC

* Data provided by citexs.com, for reference only.

Publishing research using A1989? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order