Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

TDP-43/TARDBP Rabbit pAb (A0538)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - TDP-43/TARDBP Rabbit pAb (A0538)

Western blot analysis of various lysates using TDP-43/TARDB Rabbit pAb (A0538) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)

Immunohistochemistry analysis of TDP-43/TARDB in paraffin-embedded rat heart using TDP-43/TARDB Rabbit pAb (A0538) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)

Immunohistochemistry analysis of TDP-43/TARDB in paraffin-embedded human breast cancer using TDP-43/TARDB Rabbit pAb (A0538) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)

Immunohistochemistry analysis of TDP-43/TARDB in paraffin-embedded mouse brain using TDP-43/TARDB Rabbit pAb (A0538) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name TDP-43/TARDBP Rabbit pAb
Catalog No. A0538
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human TDP-43/TARDBP (NP_031401.1).
Sequence MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Gene ID 23435
Swiss prot Q13148
Synonyms ALS10; TDP-43; TDP-43/TARDBP
Calculated MW 45kDa
Observed MW 43kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-549, K-562, Raji, Mouse brain
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

TDP-43/TARDBP Rabbit pAb images

ABclonal:Western blot - TDP-43/TARDBP Rabbit pAb (A0538)}

Western blot - TDP-43/TARDBP Rabbit pAb (A0538)

Western blot analysis of various lysates using TDP-43/TARDB Rabbit pAb (A0538) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)}

Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)

Immunohistochemistry analysis of TDP-43/TARDB in paraffin-embedded rat heart using TDP-43/TARDB Rabbit pAb (A0538) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)}

Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)

Immunohistochemistry analysis of TDP-43/TARDB in paraffin-embedded human breast cancer using TDP-43/TARDB Rabbit pAb (A0538) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)}

Immunohistochemistry - TDP-43/TARDBP Rabbit pAb (A0538)

Immunohistochemistry analysis of TDP-43/TARDB in paraffin-embedded mouse brain using TDP-43/TARDB Rabbit pAb (A0538) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A0538 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on TARDBP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to TARDBP. (Distance between topics and target gene indicate popularity.) TARDBP

* Data provided by citexs.com, for reference only.

Publishing research using A0538? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order