Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb (A19277)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb (A19277)

Western blot analysis of extracts of various cell lines, using Steroidogenic factor-1 (SF-1/NR5A1) antibody (A19277) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb
Catalog No. A19277
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2457

Background

The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 351-461 of human Steroidogenic factor-1 (SF-1/NR5A1) (Q13285).
Sequence AQELVLQLLALQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLLLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Gene ID 2516
Swiss prot Q13285
Synonyms ELP; SF1; FTZ1; POF7; SF-1; AD4BP; FTZF1; SPGF8; SRXX4; SRXY3; hSF-1; Steroidogenic factor-1 (SF-1/NR5A1)
Calculated MW 52kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples BxPC-3, Mouse ovary, Mouse spleen
Cellular location Nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb images

ABclonal:Western blot - Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb (A19277)}

Western blot - Steroidogenic factor-1 (SF-1/NR5A1) Rabbit mAb (A19277)

Western blot analysis of extracts of various cell lines, using Steroidogenic factor-1 (SF-1/NR5A1) antibody (A19277) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A19277 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on NR5A1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to NR5A1. (Distance between topics and target gene indicate popularity.) NR5A1

* Data provided by citexs.com, for reference only.

Publishing research using A19277? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order