Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SYT1 Rabbit pAb (A0992)

Review (1) Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SYT1 Rabbit pAb (A0992)

Western blot analysis of extracts of various cell lines, using SYT1 antibody (A0992) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - SYT1 Rabbit pAb (A0992)

Immunofluorescence analysis of rat eye using SYT1 Rabbit pAb (A0992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SYT1 Rabbit pAb (A0992)

Immunofluorescence analysis of mouse eye using SYT1 Rabbit pAb (A0992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for SYT1 Rabbit pAb(A0992)

You may also interested in:

Overview

Product name SYT1 Rabbit pAb
Catalog No. A0992
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the synaptotagmin protein family. The synaptotagmins are integral membrane proteins of synaptic vesicles that serve as calcium sensors in the process of vesicular trafficking and exocytosis. The encoded protein participates in triggering neurotransmitter release at the synapse in response to calcium binding. Mutations in this gene are associated with Baker-Gordon syndrome.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 84-157 of human SYT1 (NP_005630.1).
Sequence LFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNN
Gene ID 6857
Swiss prot P21579
Synonyms P65; SYT; BAGOS; SVP65; SYT1
Calculated MW 48kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples K-562, SH-SY5Y, A-549, PC-12, Mouse liver
Cellular location Cytoplasm, Cytoplasmic vesicle, Single-pass membrane protein, chromaffin granule membrane, secretory vesicle, synaptic vesicle membrane
Customer validation

WB (mouse brainMus musculus, Rattus norvegicus, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SYT1 Rabbit pAb images

ABclonal:Western blot - SYT1 Rabbit pAb (A0992)}

Western blot - SYT1 Rabbit pAb (A0992)

Western blot analysis of extracts of various cell lines, using SYT1 antibody (A0992) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - SYT1 Rabbit pAb (A0992)}

Immunofluorescence - SYT1 Rabbit pAb (A0992)

Immunofluorescence analysis of rat eye using SYT1 Rabbit pAb (A0992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SYT1 Rabbit pAb (A0992)}

Immunofluorescence - SYT1 Rabbit pAb (A0992)

Immunofluorescence analysis of mouse eye using SYT1 Rabbit pAb (A0992) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A0992

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0992 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SYT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SYT1. (Distance between topics and target gene indicate popularity.) SYT1

* Data provided by citexs.com, for reference only.

Publishing research using A0992? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order