Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SUMO4 Rabbit pAb (A3100)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - SUMO4 Rabbit pAb (A3100)

Western blot analysis of extracts of various cell lines, using SUMO4 antibody (A3100) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Immunohistochemistry - SUMO4 Rabbit pAb (A3100)

Immunohistochemistry analysis of paraffin-embedded human appendicitis using SUMO4 Antibody (A3100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SUMO4 Rabbit pAb (A3100)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using SUMO4 Antibody (A3100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SUMO4 Rabbit pAb (A3100)

Immunohistochemistry analysis of paraffin-embedded human kidney cancer using SUMO4 Antibody (A3100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name SUMO4 Rabbit pAb
Catalog No. A3100
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 40-95 of human SUMO4 (Q6EEV6).
Sequence LSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Gene ID 387082
Swiss prot Q6EEV6
Synonyms IDDM5; SMT3H4; SUMO-4; dJ281H8.4; SUMO4
Calculated MW 11kDa
Observed MW 18kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:2000
  • IHC-P 1:100 - 1:300
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat, MCF7
Cellular location nucleus

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SUMO4 Rabbit pAb images

ABclonal:Western blot - SUMO4 Rabbit pAb (A3100)}

Western blot - SUMO4 Rabbit pAb (A3100)

Western blot analysis of extracts of various cell lines, using SUMO4 antibody (A3100) at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Immunohistochemistry - SUMO4 Rabbit pAb (A3100)}

Immunohistochemistry - SUMO4 Rabbit pAb (A3100)

Immunohistochemistry analysis of paraffin-embedded human appendicitis using SUMO4 Antibody (A3100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SUMO4 Rabbit pAb (A3100)}

Immunohistochemistry - SUMO4 Rabbit pAb (A3100)

Immunohistochemistry analysis of paraffin-embedded human breast cancer using SUMO4 Antibody (A3100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SUMO4 Rabbit pAb (A3100)}

Immunohistochemistry - SUMO4 Rabbit pAb (A3100)

Immunohistochemistry analysis of paraffin-embedded human kidney cancer using SUMO4 Antibody (A3100) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A3100 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SUMO4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SUMO4. (Distance between topics and target gene indicate popularity.) SUMO4

* Data provided by citexs.com, for reference only.

Publishing research using A3100? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order