Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

STAT1 Rabbit pAb (A12075)

Reviews (2) Publications (18) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - STAT1 Rabbit pAb (A12075)

Western blot analysis of lysates from HeLa cells, using STAT1 Rabbit pAb (A12075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - STAT1 Rabbit pAb (A12075)

Western blot analysis of various lysates using STAT1 Rabbit pAb (A12075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180.

ABclonal:Immunohistochemistry - STAT1 Rabbit pAb (A12075)

Immunohistochemistry analysis of STAT1 in paraffin-embedded rat ovary using STAT1 Rabbit pAb (A12075) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - STAT1 Rabbit pAb (A12075)

Immunofluorescence analysis of L929 cells using STAT1 Rabbit pAb (A12075) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - STAT1 Rabbit pAb (A12075)

Immunoprecipitation analysis of 200 μg extracts of U-87MG cells using 3 μg STAT1 antibody (A12075). Western blot was performed from the immunoprecipitate using STAT1 antibody (A12075) at a dilution of 1:1000.

ABclonal:Immunoprecipitation - STAT1 Rabbit pAb (A12075)

Immunoprecipitation analysis of 200 μg extracts of U-87MG cells using 3 μg STAT1 Rabbit pAb (A12075). Western blot was performed from the immunoprecipitate using STAT1 Rabbit pAb (A12075) at a dilition of 1:500.

Review
ABclonal: review for STAT1 Rabbit pAb(A12075)
Review
ABclonal: review for STAT1 Rabbit pAb(A12075)

You may also interested in:

Overview

Product name STAT1 Rabbit pAb
Catalog No. A12075
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 650-750 of human STAT1 (NP_009330.1).
Sequence NYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
Gene ID 6772
Swiss prot P42224
Synonyms CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91; STAT1
Calculated MW 87kDa
Observed MW 91kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, Mouse spleen, Rat spleen
Cellular location Cytoplasm, Nucleus
Customer validation

IF (HeLa cells)

WB (Human chronic myeloid leukemia cellsMus musculus, Mus musculus, Homo sapiens)

IP (Mus musculus)

ChIP (Homo sapiens)

Co-IP (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

STAT1 Rabbit pAb images

ABclonal:Western blot - STAT1 Rabbit pAb (A12075)}

Western blot - STAT1 Rabbit pAb (A12075)

Western blot analysis of lysates from HeLa cells, using STAT1 Rabbit pAb (A12075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - STAT1 Rabbit pAb (A12075)}

Western blot - STAT1 Rabbit pAb (A12075)

Western blot analysis of various lysates using STAT1 Rabbit pAb (A12075) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180.
ABclonal:Immunohistochemistry - STAT1 Rabbit pAb (A12075)}

Immunohistochemistry - STAT1 Rabbit pAb (A12075)

Immunohistochemistry analysis of STAT1 in paraffin-embedded rat ovary using STAT1 Rabbit pAb (A12075) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - STAT1 Rabbit pAb (A12075)}

Immunofluorescence - STAT1 Rabbit pAb (A12075)

Immunofluorescence analysis of L929 cells using STAT1 Rabbit pAb (A12075) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - STAT1 Rabbit pAb (A12075)}

Immunoprecipitation - STAT1 Rabbit pAb (A12075)

Immunoprecipitation analysis of 200 μg extracts of U-87MG cells using 3 μg STAT1 antibody (A12075). Western blot was performed from the immunoprecipitate using STAT1 antibody (A12075) at a dilution of 1:1000.
ABclonal:Immunoprecipitation - STAT1 Rabbit pAb (A12075)}

Immunoprecipitation - STAT1 Rabbit pAb (A12075)

Immunoprecipitation analysis of 200 μg extracts of U-87MG cells using 3 μg STAT1 Rabbit pAb (A12075). Western blot was performed from the immunoprecipitate using STAT1 Rabbit pAb (A12075) at a dilition of 1:500.

Submit an review for A12075

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A12075 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on STAT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to STAT1. (Distance between topics and target gene indicate popularity.) STAT1

* Data provided by citexs.com, for reference only.

Publishing research using A12075? Please let us know so that we can cite the reference in this datasheet.

Antibodies (9)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order