Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

STAMBP Rabbit pAb (A7065)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - STAMBP Rabbit pAb (A7065)

Western blot analysis of various lysates using STAMBP Rabbit pAb (A7065) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - STAMBP Rabbit pAb (A7065)

Immunohistochemistry analysis of STAMBP in paraffin-embedded rat spleen using STAMBP Rabbit pAb (A7065) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - STAMBP Rabbit pAb (A7065)

Immunohistochemistry analysis of STAMBP in paraffin-embedded human stomach using STAMBP Rabbit pAb (A7065) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - STAMBP Rabbit pAb (A7065)

Immunofluorescence analysis of U2OS cells using STAMBP Rabbit pAb (A7065). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name STAMBP Rabbit pAb
Catalog No. A7065
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Cytokine-mediated signal transduction in the JAK-STAT cascade requires the involvement of adaptor molecules. One such signal-transducing adaptor molecule contains an SH3 domain that is required for induction of MYC and cell growth. The protein encoded by this gene binds to the SH3 domain of the signal-transducing adaptor molecule, and plays a critical role in cytokine-mediated signaling for MYC induction and cell cycle progression. Multiple alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human STAMBP (NP_998787.1).
Sequence FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQL
Gene ID 10617
Swiss prot O95630
Synonyms AMSH; MICCAP; STAMBP
Calculated MW 48kDa
Observed MW 48kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples MCF7, SW480, HepG2, HeLa, 293T, Mouse brain, Rat lung, Rat liver
Cellular location Cytoplasm, Early endosome, Membrane, Nucleus, Peripheral membrane protein

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

STAMBP Rabbit pAb images

ABclonal:Western blot - STAMBP Rabbit pAb (A7065)}

Western blot - STAMBP Rabbit pAb (A7065)

Western blot analysis of various lysates using STAMBP Rabbit pAb (A7065) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - STAMBP Rabbit pAb (A7065)}

Immunohistochemistry - STAMBP Rabbit pAb (A7065)

Immunohistochemistry analysis of STAMBP in paraffin-embedded rat spleen using STAMBP Rabbit pAb (A7065) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - STAMBP Rabbit pAb (A7065)}

Immunohistochemistry - STAMBP Rabbit pAb (A7065)

Immunohistochemistry analysis of STAMBP in paraffin-embedded human stomach using STAMBP Rabbit pAb (A7065) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - STAMBP Rabbit pAb (A7065)}

Immunofluorescence - STAMBP Rabbit pAb (A7065)

Immunofluorescence analysis of U2OS cells using STAMBP Rabbit pAb (A7065). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7065 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on STAMBP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to STAMBP. (Distance between topics and target gene indicate popularity.) STAMBP

* Data provided by citexs.com, for reference only.

Publishing research using A7065? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order