Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

SRSF3 Rabbit pAb (A6067)

Review (1) Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - SRSF3 Rabbit pAb (A6067)

Western blot analysis of various lysates using SRSF3 Rabbit pAb (A6067) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - SRSF3 Rabbit pAb (A6067)

Immunohistochemistry analysis of SRSF3 in paraffin-embedded Rat brain using SRSF3 Rabbit pAb (A6067) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SRSF3 Rabbit pAb (A6067)

Immunohistochemistry analysis of SRSF3 in paraffin-embedded Human mammary cancer using SRSF3 Rabbit pAb (A6067) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - SRSF3 Rabbit pAb (A6067)

Immunohistochemistry analysis of SRSF3 in paraffin-embedded Mouse testis using SRSF3 Rabbit pAb (A6067) at dilution of 1:100 (20x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - SRSF3 Rabbit pAb (A6067)

Immunofluorescence analysis of C6 cells using SRSF3 Rabbit pAb (A6067) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SRSF3 Rabbit pAb (A6067)

Immunofluorescence analysis of NIH/3T3 cells using SRSF3 Rabbit pAb (A6067) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - SRSF3 Rabbit pAb (A6067)

Immunofluorescence analysis of U-2 OS cells using SRSF3 Rabbit pAb (A6067) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Review
ABclonal: review for SRSF3 Rabbit pAb(A6067)

You may also interested in:

Overview

Product name SRSF3 Rabbit pAb
Catalog No. A6067
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SRSF3 (NP_003008.1).
Sequence MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNR
Gene ID 6428
Swiss prot P84103
Synonyms SFRS3; SRp20; SRSF3
Calculated MW 19kDa
Observed MW 22kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:100 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples U-87MG, HeLa, K-562, NIH/3T3, PC-12, Mouse brain, Mouse thymus, Rat brain
Cellular location Cytoplasm, Nucleus
Customer validation

WB (293TRana amurensis Boulenger)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

SRSF3 Rabbit pAb images

ABclonal:Western blot - SRSF3 Rabbit pAb (A6067)}

Western blot - SRSF3 Rabbit pAb (A6067)

Western blot analysis of various lysates using SRSF3 Rabbit pAb (A6067) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - SRSF3 Rabbit pAb (A6067)}

Immunohistochemistry - SRSF3 Rabbit pAb (A6067)

Immunohistochemistry analysis of SRSF3 in paraffin-embedded Rat brain using SRSF3 Rabbit pAb (A6067) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SRSF3 Rabbit pAb (A6067)}

Immunohistochemistry - SRSF3 Rabbit pAb (A6067)

Immunohistochemistry analysis of SRSF3 in paraffin-embedded Human mammary cancer using SRSF3 Rabbit pAb (A6067) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - SRSF3 Rabbit pAb (A6067)}

Immunohistochemistry - SRSF3 Rabbit pAb (A6067)

Immunohistochemistry analysis of SRSF3 in paraffin-embedded Mouse testis using SRSF3 Rabbit pAb (A6067) at dilution of 1:100 (20x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - SRSF3 Rabbit pAb (A6067)}

Immunofluorescence - SRSF3 Rabbit pAb (A6067)

Immunofluorescence analysis of C6 cells using SRSF3 Rabbit pAb (A6067) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SRSF3 Rabbit pAb (A6067)}

Immunofluorescence - SRSF3 Rabbit pAb (A6067)

Immunofluorescence analysis of NIH/3T3 cells using SRSF3 Rabbit pAb (A6067) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - SRSF3 Rabbit pAb (A6067)}

Immunofluorescence - SRSF3 Rabbit pAb (A6067)

Immunofluorescence analysis of U-2 OS cells using SRSF3 Rabbit pAb (A6067) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Submit an review for A6067

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A6067 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on SRSF3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to SRSF3. (Distance between topics and target gene indicate popularity.) SRSF3

* Data provided by citexs.com, for reference only.

Publishing research using A6067? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order